PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100225510021
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family ZF-HD
Protein Properties Length: 177aa    MW: 20691.4 Da    PI: 9.7311
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100225510021genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer93.51.8e-293789357
                   ZF-HD_dimer  3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57
                                   vrY+eClkNhAa++G+++vDGC+Efmp  gee +a  ++CaAC+CHRnFHR+e 
  Ote100225510021|100225510021 37 DVRYRECLKNHAANMGSYVVDGCREFMPR-GEE-EALRMRCAACDCHRNFHRKEA 89
                                  69**************************9.444.68899**************96 PP

2Homeobox16.21.8e-05109169157
                                   TT--SS--HHHHHHHHHHHH....HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                      Homeobox   1 rrkRttftkeqleeLeelFe....knrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                                   +r Rt+f++eq ++++el e    ++ + ++e+ ++L +++g++ ++ kvW +N ++ +kk
  Ote100225510021|100225510021 109 KRFRTKFSQEQKDRMQELAEklgwRTEKEDEEQVQRLCNETGVKRQVFKVWMHNNKQAMKK 169
                                   789**************99977777********************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-163888IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047708.8E-273889IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015665.0E-243988IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152324.1854088IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466893.25E-1898169IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.7E-29105170IPR009057Homeodomain-like
PROSITE profilePS500719.799106170IPR001356Homeobox domain
TIGRFAMsTIGR015659.3E-25108165IPR006455Homeodomain, ZF-HD class
CDDcd000860.00937109171No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MERRHQPQGP AFYANAEVSD HHLPSTATPP ETSNRGDVRY RECLKNHAAN MGSYVVDGCR  60
EFMPRGEEEA LRMRCAACDC HRNFHRKEAV LLNNPNSGYQ GTGFVSPKKR FRTKFSQEQK  120
DRMQELAEKL GWRTEKEDEE QVQRLCNETG VKRQVFKVWM HNNKQAMKKK KNITQIH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh5_A4e-211081661775ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002310240.22e-54zinc finger family protein
SwissprotQ9ZPW74e-50ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLB9HF112e-54B9HF11_POPTR; Zinc finger family protein
STRINGscaffold_304185.14e-49(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128